PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01372.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 296aa    MW: 32904.2 Da    PI: 5.0609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01372.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.9e-142774148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT +Ed  l+  v   G g+W+  ar  g++Rt+k+c++rw++yl
  Zmw_sc01372.1.g00110.1.am.mk 27 RGPWTVDEDAVLASHVSARGEGRWNELARAAGLRRTGKSCRLRWLNYL 74
                                  89********************************************97 PP

2Myb_DNA-binding48.91.5e-1580123146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg +T+ E++l ++++ ++G++ W++Ia++++ gRt++++k++w++
  Zmw_sc01372.1.g00110.1.am.mk  80 RGDFTPREQLLVLELHSRWGNR-WSRIAAHLP-GRTDNEVKNYWRT 123
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5852274IPR017930Myb domain
SuperFamilySSF466891.05E-2825121IPR009057Homeodomain-like
SMARTSM007173.5E-102676IPR001005SANT/Myb domain
PfamPF002494.2E-122774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-192881IPR009057Homeodomain-like
CDDcd001671.47E-72974No hitNo description
PROSITE profilePS5129421.8175129IPR017930Myb domain
SMARTSM007172.8E-1479127IPR001005SANT/Myb domain
PfamPF002491.1E-1480123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2382127IPR009057Homeodomain-like
CDDcd001676.51E-1183123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEGLWMGSYD WTTAATSEVD DAAELRRGPW TVDEDAVLAS HVSARGEGRW NELARAAGLR  60
RTGKSCRLRW LNYLRPGVRR GDFTPREQLL VLELHSRWGN RWSRIAAHLP GRTDNEVKNY  120
WRTRVQKHAR QLGCDVGSRR FHDVMRNHWL PRLVERIYTD SAAAVDDHDA SASHPAAVPS  180
LTAGQSVAPA PPNNCGGLVE PCASSDASSA TTGQSSSDSS HEAQFQTDSP IMTAAGTDCW  240
SSTEQCQYDM LDGSWSDLLA RASHDESDSA ELHDLELDEA VVNFWSLDDI WLQQLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-242412724126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967585.11e-108PREDICTED: myb-related protein Myb4-like
TrEMBLK3XKM31e-108K3XKM3_SETIT; Uncharacterized protein
STRINGSi002446m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330